Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Botensilimab Biosimilar – Anti-CTLA4 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $217.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Botensilimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Product name Botensilimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Source CAS 2408310-37-0
Species Homo sapiens
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Botensilimab,AGEN1181, BOTENSILIMAB,CTLA4,anti-CTLA4
Reference PX-TA1647
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1,Kappa
Clonality Monoclonal Antibody
Product name Botensilimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Source CAS 2408310-37-0
Species Homo sapiens
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Botensilimab,AGEN1181, BOTENSILIMAB,CTLA4,anti-CTLA4
Reference PX-TA1647
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1,Kappa
Clonality Monoclonal Antibody
Product name PX-TA1647-50
Uniprot ID P16410
Source CAS 2408310-37-0
Species Homo sapiens
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Botensilimab,AGEN1181, BOTENSILIMAB,CTLA4,anti-CTLA4
Reference PX-TA1647
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Botensilimab Biosimilar, also known as Anti-CTLA4 mAb, is a monoclonal antibody that targets the cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). It is a research grade therapeutic antibody that has shown promising results in pre-clinical studies and is currently being evaluated in clinical trials for its potential use in the treatment of various diseases.

Structure of Botensilimab Biosimilar

Botensilimab Biosimilar is a humanized IgG1 monoclonal antibody, meaning it is derived from both human and mouse sources. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to its target, CTLA-4, while the constant region plays a role in effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

Botensilimab Biosimilar works by binding to CTLA-4, a protein found on the surface of T-cells. CTLA-4 is a negative regulator of T-cell activation, meaning it inhibits the activation and proliferation of T-cells. By binding to CTLA-4, Botensilimab Biosimilar blocks its inhibitory function, leading to increased T-cell activation and proliferation. This, in turn, enhances the immune response against cancer cells or other disease targets.

Application of Botensilimab Biosimilar

The primary application of Botensilimab Biosimilar is in the treatment of cancer. It is being evaluated in clinical trials for its potential use in various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. By targeting CTLA-4, Botensilimab Biosimilar enhances the immune response against cancer cells, leading to their destruction.

In addition to cancer, Botensilimab Biosimilar also has potential applications in autoimmune diseases. CTLA-4 is involved in the regulation of the immune response, and its dysfunction has been linked to autoimmune disorders such as rheumatoid arthritis and multiple sclerosis. By blocking CTLA-4, Botensilimab Biosimilar could potentially modulate the immune response and provide therapeutic benefits in these diseases.

Research Grade Antibody

Botensilimab Biosimilar is currently being developed as a research grade antibody, meaning it is primarily intended for use in laboratory research and not for clinical use. However, the data gathered from pre-clinical and clinical studies will provide valuable insights into the safety and efficacy of the antibody, which will be crucial for its potential future use as a therapeutic agent.

Conclusion

In summary, Botensilimab Biosimilar is a promising monoclonal antibody that targets CTLA-4 and has potential applications in the treatment of cancer and autoimmune diseases. Its structure and mechanism of action make it a valuable tool for researchers in understanding the role of CTLA-4 in various diseases. As clinical trials continue to evaluate its safety and efficacy, Botensilimab Biosimilar may prove to be a valuable therapeutic option for patients in the future.

Botensilimab Biosimilar - Anti-CTLA4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Botensilimab Biosimilar – Anti-CTLA4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products