Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Encelimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Encelimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

Product name Encelimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Species Humanized
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Encelimab ,TSR-033,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1586
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Encelimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Species Humanized
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Encelimab ,TSR-033,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1586
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1586-50
Uniprot ID P18627
Species Humanized
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Encelimab ,TSR-033,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1586
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction to Encelimab Biosimilar – Anti-LAG3, CD223 mAb

Encelimab Biosimilar – Anti-LAG3, CD223 mAb is a novel therapeutic antibody that has emerged as a promising treatment option for various autoimmune diseases and cancers. This biosimilar is designed to target the lymphocyte activation gene 3 (LAG3) protein, which plays a crucial role in regulating immune responses. In this article, we will explore the structure, activity, and potential applications of Encelimab Biosimilar in detail.

Structure of Encelimab Biosimilar

Encelimab Biosimilar is a monoclonal antibody (mAb) that is produced using recombinant DNA technology. It is a biosimilar of the anti-LAG3 antibody, which is a fully human IgG4 antibody. The antibody consists of two heavy chains and two light chains, each containing a variable and constant region. The variable region is responsible for binding to the LAG3 protein, while the constant region determines the antibody’s effector functions.

Activity of Encelimab Biosimilar

The primary mechanism of action of Encelimab Biosimilar is its ability to block the LAG3 protein. LAG3 is a cell surface receptor that is expressed on various immune cells, including T cells, B cells, and natural killer cells. It acts as an inhibitory receptor and plays a crucial role in regulating immune responses. When LAG3 binds to its ligand, it suppresses the activation and proliferation of immune cells, leading to immune tolerance.

Encelimab Biosimilar binds to the LAG3 protein and blocks its interaction with its ligand, thereby inhibiting its inhibitory function. This results in the activation and proliferation of immune cells, leading to an enhanced immune response against cancer cells or autoimmune diseases. Additionally, Encelimab Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) to kill target cells expressing LAG3.

Applications of Encelimab Biosimilar

Encelimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for various indications. The most significant potential application of this biosimilar is in the treatment of cancers, particularly those that are resistant to current immunotherapies. LAG3 is highly expressed on tumor-infiltrating lymphocytes and has been associated with poor prognosis in various cancers, making it an attractive therapeutic target.

Encelimab Biosimilar is also being investigated for its potential to treat autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis. In these conditions, LAG3 plays a crucial role in suppressing the immune response, leading to disease progression. By blocking LAG3, Encelimab Biosimilar can restore immune balance and potentially improve disease outcomes.

Conclusion

Encelimab Biosimilar – Anti-LAG3, CD223 mAb is a promising therapeutic antibody that targets the LAG3 protein to enhance immune responses against cancer and autoimmune diseases. Its unique mechanism of action and potential applications make it a valuable addition to the current treatment options available. With ongoing clinical trials, Encelimab Biosimilar has the potential to improve the lives of patients suffering from these diseases.

SDS-PAGE for Encelimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade

SDS-PAGE for Encelimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade

Encelimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Encelimab  Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

There are no reviews yet.

Be the first to review “Encelimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products