Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Relatlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $203.00.Current price is: $167.00.

50ug 18% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Relatlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

Product name Relatlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Source CAS 1673516-98-7
Species Homo sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Relatlimab,BMS-986016,ONO-4482,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1496
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Relatlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Source CAS 1673516-98-7
Species Homo sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Relatlimab,BMS-986016,ONO-4482,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1496
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1496-50
Uniprot ID P18627
Source CAS 1673516-98-7
Species Homo sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Relatlimab,BMS-986016,ONO-4482,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1496
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Relatlimab Biosimilar, also known as Anti-LAG3, CD223 mAb, is a promising antibody that has gained attention in the field of cancer immunotherapy. This biosimilar is a monoclonal antibody that targets Lymphocyte activation gene 3 (LAG3), a protein found on the surface of immune cells. In this article, we will explore the structure, activity, and potential applications of Relatlimab Biosimilar in cancer research.

Structure of Relatlimab Biosimilar

Relatlimab Biosimilar is a recombinant humanized monoclonal antibody that is designed to mimic the structure of the original antibody, Relatlimab. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy and light chains are made up of amino acid sequences that are carefully selected to specifically bind to LAG3 on immune cells.

Activity of Relatlimab Biosimilar

Relatlimab Biosimilar works by blocking the activity of LAG3, a protein that is known to suppress immune responses. LAG3 is expressed on the surface of T cells, B cells, and natural killer cells, and plays a crucial role in regulating immune responses. When LAG3 binds to its ligand, it inhibits the activation and proliferation of immune cells, thus suppressing the immune response. In cancer, LAG3 is often overexpressed, leading to immune evasion and tumor growth. Relatlimab Biosimilar binds to LAG3, preventing its interaction with its ligand and allowing immune cells to be activated and attack cancer cells.

Potential Applications of Relatlimab Biosimilar

Relatlimab Biosimilar has shown promising results in preclinical and clinical studies as a potential treatment for various types of cancer. It has been shown to enhance the activity of other immunotherapies, such as anti-PD-1 antibodies, and has shown efficacy in both solid tumors and hematologic malignancies.

1. Treatment of Melanoma

Melanoma is a type of skin

cancer that is known to be resistant to conventional treatments. In a phase I/II clinical trial, Relatlimab Biosimilar showed promising results as a monotherapy in patients with advanced melanoma. It was well-tolerated and showed antitumor activity, with some patients experiencing complete or partial responses.

2. Combination Therapy for Solid Tumors Relatlimab Biosimilar has also shown potential as a combination therapy with other immunotherapies in solid tumors. In a phase I/II clinical trial, Relatlimab Biosimilar in combination with anti-PD-1 antibody, Nivolumab, showed promising results in patients with advanced non-small cell lung cancer. The combination therapy was well-tolerated and showed improved efficacy compared to Nivolumab alone.

3. Treatment of Hematologic Malignancies Relatlimab Biosimilar has also shown potential in the treatment of hematologic malignancies, such as lymphoma and leukemia. In a phase I clinical trial, Relatlimab Biosimilar showed promising results in patients with relapsed or refractory lymphoma. It was well-tolerated and showed antitumor activity, with some patients experiencing complete or partial responses.

Conclusion

In conclusion, Relatlimab Biosimilar is a promising antibody that targets LAG3, a protein involved in immune suppression. Its unique structure and activity make it a potential treatment for various types of cancer. It has shown promising results in preclinical and clinical studies, and further research is needed to fully understand its potential in cancer treatment. Relatlimab Biosimilar has the potential to improve the outcomes of cancer patients and bring us closer to achieving effective cancer immunotherapy.

SDS-PAGE for Relatlimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade

SDS-PAGE for Relatlimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade

Relatlimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Relatlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

There are no reviews yet.

Be the first to review “Relatlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products