Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

CD66d recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P40198
Molecular weight:
17.16kDa

Original price was: $650.00.Current price is: $500.00.

100ug 23% OFF + 500 loyalty points
Met1–Gly155 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
CD66d recombinant protein

CD66d recombinant protein

Product name PX-P5133-100
Uniprot ID P40198
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Molecular weight 17.16kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly155
Protein Accession P40198
Aliases /Synonyms CEACAM3, CGM1
Reference PX-P5133
Note For research use only
Molecular Constructor
Met1–Gly155 His
Product name PX-P5133-1MG
Uniprot ID P40198
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Molecular weight 17.16kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly155
Protein Accession P40198
Aliases /Synonyms CEACAM3, CGM1
Reference PX-P5133
Note For research use only
Molecular Constructor
Met1–Gly155 His
Product name PX-P5133-50
Uniprot ID P40198
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Molecular weight 17.16kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly155
Protein Accession P40198
Aliases /Synonyms CEACAM3, CGM1
Reference PX-P5133
Note For research use only
Molecular Constructor
Met1–Gly155 His

CD66d recombinant protein

There are no reviews yet.

Be the first to review “CD66d recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products