Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

T cell receptor delta variable 1(TRDV1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A1B0GX56
Molecular weight:
13kDa

$217.00

50ug + 217 loyalty points
Gln22–Glu115 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

T cell receptor delta variable 1(TRDV1)

Product name T cell receptor delta variable 1(TRDV1)
Uniprot ID A0A1B0GX56
Uniprot link https://www.uniprot.org/uniprot/A0A1B0GX56
Expression system Prokaryotic expression
Sequence MQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEDYKDDDDKHHHHHHHH
Molecular weight 13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln22-Glu115
Protein Accession A0A1B0GX56
NCBI Reference A0A1B0GX56
Reference PX-P4655
Note For research use only
Molecular Constructor
Gln22–Glu115 His
Product name T cell receptor delta variable 1(TRDV1)
Uniprot ID A0A1B0GX56
Uniprot link https://www.uniprot.org/uniprot/A0A1B0GX56
Expression system Prokaryotic expression
Sequence MQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEDYKDDDDKHHHHHHHH
Molecular weight 13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln22-Glu115
Protein Accession A0A1B0GX56
NCBI Reference A0A1B0GX56
Reference PX-P4655
Note For research use only
Molecular Constructor
Gln22–Glu115 His

SDS-PAGE for T cell receptor delta variable 1(TRDV1)

SDS-PAGE for T cell receptor delta variable 1(TRDV1)

T cell receptor delta variable 1(TRDV1), on SDS-PAGE under reducing

There are no reviews yet.

Be the first to review “T cell receptor delta variable 1(TRDV1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products