Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Receptor-interacting serine, threonine-protein kinase 4(RIPK4)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P57078
Molecular weight:
57.6kDa

$392.00

100ug + 392 loyalty points
GST Phe22–Ile286
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Receptor-interacting serine, threonine-protein kinase 4(RIPK4)

Product name Receptor-interacting serine, threonine-protein kinase 4(RIPK4)
Uniprot ID P57078
Uniprot link https://www.uniprot.org/uniprot/P57078
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELI
Molecular weight 57.6kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe22-Ile286
Protein Accession P57078
Spec:SwissProtID Q96KH0
NCBI Reference P57078
Aliases /Synonyms ANKRD3, DIK,Ankyrin repeat domain-containing protein 3,PKC-delta-interacting protein kinase
Reference PX-P4863
Note For research use only
Molecular Constructor
GST Phe22–Ile286
Product name Receptor-interacting serine, threonine-protein kinase 4(RIPK4)
Uniprot ID P57078
Uniprot link https://www.uniprot.org/uniprot/P57078
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELI
Molecular weight 57.6kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe22-Ile286
Protein Accession P57078
Spec:SwissProtID Q96KH0
NCBI Reference P57078
Aliases /Synonyms ANKRD3, DIK,Ankyrin repeat domain-containing protein 3,PKC-delta-interacting protein kinase
Reference PX-P4863
Note For research use only
Molecular Constructor
GST Phe22–Ile286

There are no reviews yet.

Be the first to review “Receptor-interacting serine, threonine-protein kinase 4(RIPK4)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products