Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lipolysis-stimulated lipoprotein receptor(LSR)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q86X29
Molecular weight:
13.5kDa

$250.00

50ug + 250 loyalty points
His Met431–Ser540
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lipolysis-stimulated lipoprotein receptor(LSR)

Product name Lipolysis-stimulated lipoprotein receptor(LSR)
Uniprot ID Q86X29
Uniprot link https://www.uniprot.org/uniprot/Q86X29
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDD LTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDS
Molecular weight 13.5kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met431-Ser540
Protein Accession Q86X29
Spec:Entrez GeneID 51599
Spec:NCBI Gene Aliases ILDR3; LISCH7
Spec:SwissProtID Q6ZT80
NCBI Reference Q86X29
Aliases /Synonyms LISCH
Reference PX-P4845
Note For research use only
Molecular Constructor
His Met431–Ser540
Product name Lipolysis-stimulated lipoprotein receptor(LSR)
Uniprot ID Q86X29
Uniprot link https://www.uniprot.org/uniprot/Q86X29
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDD LTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDS
Molecular weight 13.5kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met431-Ser540
Protein Accession Q86X29
Spec:Entrez GeneID 51599
Spec:NCBI Gene Aliases ILDR3; LISCH7
Spec:SwissProtID Q6ZT80
NCBI Reference Q86X29
Aliases /Synonyms LISCH
Reference PX-P4845
Note For research use only
Molecular Constructor
His Met431–Ser540

There are no reviews yet.

Be the first to review “Lipolysis-stimulated lipoprotein receptor(LSR)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products