Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

6His-3C-HNS Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Escherichia coli (E.coli)
Uniprot ID:
P0ACF9
Molecular weight:
17.63kDa

Original price was: $275.00.Current price is: $250.00.

50ug 9% OFF + 250 loyalty points
Met1–Gln137
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

6His-3C-HNS Protein

Product name 6His-3C-HNS Protein
Uniprot ID P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Origin species Escherichia coli (E.coli)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight 17.63kDa
Purity estimated 70%
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln137
Aliases /Synonyms DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference PX-P4261
Note For research use only
Molecular Constructor
Met1–Gln137
Product name 6His-3C-HNS Protein
Uniprot ID P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Origin species Escherichia coli (E.coli)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight 17.63kDa
Purity estimated 70%
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln137
Aliases /Synonyms DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference PX-P4261
Note For research use only
Molecular Constructor
Met1–Gln137
Product name PX-P4261-1MG
Uniprot ID P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Origin species Escherichia coli (E.coli)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight 17.63kDa
Purity estimated 70%
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gln137
Aliases /Synonyms DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference PX-P4261
Note For research use only
Molecular Constructor
Met1–Gln137

General information on H-NS Protein

H-NS protein stands for histone-like nucleoid structuring protein. The latter is a major component of the folded chromosome in Escherichia coli and related bacteria. This protein belongs to a family of bacterial proteins that involved in the formation of nucleoid structure and are linked to gene expression under certain conditions. H-NS protein has a homologue that is encoded by several conjugative plasmids. The protein more specifically has been linked to management of genome evolution, DNA condensation and transcription. H-NS protein has also been linked to possessing rudimentary determinants for self-association, hetero-oligomerization and DNA binding.
H-NS protein is responsible for bacterial chromosome compaction and organization. H-NS binds to AT-rich dsDNA which eventually leads to the inhibition of transcription process. This is essential for the regulation of gene expression. The suppression of H-NS protein activity can be achieved by the binding of another protein or by changing DNA topology. This protein is also involved in the upstream and downstream binding of this protein to the RNA polymerase which eventually prevents the transcription. Another major function of H-NS protein is its influence in DNA topology. It is believed that the protein achieves this by forming complexes with itself and binding to different DNA sections. Other functions of the protein involve its interaction with proteins and influencing their function. For instance, H-NS protein interacts with flagellar motor protein (FliG) which results in the increase of FliG activity.
The three-dimensional structure of the C-terminal domain (47 residues) of H-NS protein is composed of an antiparallel beta-sheet, an alpha-helix and a 3(10)-helix which builds a hydrophobic core that stabilizes the whole structure. This domain is responsible for DNA binding. The protein is capable of high-order self-association via interactions of its oligomerization domain. The crystallography shows a superhelical structure which establishes a mechanism for the self-association of H-NS via both an N-terminal antiparallel coiled-coil and a second, hitherto unidentified, helix-turn-helix dimerization interface at the C-terminal end of the oligomerization domain.

6His-3C-HNS Protein

There are no reviews yet.

Be the first to review “6His-3C-HNS Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products