Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Nuclear factor NF-kappa-B p105 subunit(NFKB1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P19838
Molecular weight:
35.98kDa

$392.00

100ug + 392 loyalty points
His Asp40–Tyr349
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Nuclear factor NF-kappa-B p105 subunit(NFKB1)

Nuclear factor NF-kappa-B p105 subunit(NFKB1)

Product name Nuclear factor NF-kappa-B p105 subunit(NFKB1)
Uniprot ID P19838
Uniprot link https://www.uniprot.org/uniprot/P19838
Expression system Prokaryotic expression
Sequence MGTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYLEHHHHHH
Molecular weight 35.98kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Tyr349
Protein Accession P19838
Spec:Entrez GeneID 4790
Spec:NCBI Gene Aliases KBF1; EBP-1; NF-kB; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B1; NF-kappabeta
Spec:SwissProtID Q68D84
NCBI Reference P19838
Aliases /Synonyms DNA-binding factor KBF1,EBP-1,Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1,
Reference PX-P4764
Note For research use only
Molecular Constructor
His Asp40–Tyr349
Product name Nuclear factor NF-kappa-B p105 subunit(NFKB1)
Uniprot ID P19838
Uniprot link https://www.uniprot.org/uniprot/P19838
Expression system Prokaryotic expression
Sequence MGTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYLEHHHHHH
Molecular weight 35.98kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Tyr349
Protein Accession P19838
Spec:Entrez GeneID 4790
Spec:NCBI Gene Aliases KBF1; EBP-1; NF-kB; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B1; NF-kappabeta
Spec:SwissProtID Q68D84
NCBI Reference P19838
Aliases /Synonyms DNA-binding factor KBF1,EBP-1,Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1,
Reference PX-P4764
Note For research use only
Molecular Constructor
His Asp40–Tyr349

There are no reviews yet.

Be the first to review “Nuclear factor NF-kappa-B p105 subunit(NFKB1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products