Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

KAT8 regulatory NSL complex subunit 1(Kansl1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q80TG1
Molecular weight:
25.60kDa

Original price was: $307.00.Current price is: $250.00.

50ug 19% OFF + 250 loyalty points
Lys814–Arg1036
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

KAT8 regulatory NSL complex subunit 1(Kansl1)

Product name KAT8 regulatory NSL complex subunit 1(Kansl1)
Uniprot ID Q80TG1
Uniprot link https://www.uniprot.org/uniprot/Q80TG1
Expression system Prokaryotic expression
Raw Antigen Sequence KEILTPSWREVDVQSLKGSPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLGSANPSTPQPASPDVSSSHSLSEFSHGQSPRSPISPELHSAPLTPVARDSLRHLASEDTRCSTPELGLDEQSVQPWERRTFPLAYSPQAECEEQLDAQDTAARCTRRTSGSKTGREAEVAPTSPPVVPLKSRHLAATVTAQRPAHR
Molecular weight 25.60kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys814-Arg1036
Aliases /Synonyms NSL complex protein NSL1,Non-specific lethal 1 homolog,Kiaa1267, Nsl1
Reference PX-P4737
Note For research use only
Molecular Constructor
Lys814–Arg1036
Product name KAT8 regulatory NSL complex subunit 1(Kansl1)
Uniprot ID Q80TG1
Uniprot link https://www.uniprot.org/uniprot/Q80TG1
Expression system Prokaryotic expression
Raw Antigen Sequence KEILTPSWREVDVQSLKGSPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLGSANPSTPQPASPDVSSSHSLSEFSHGQSPRSPISPELHSAPLTPVARDSLRHLASEDTRCSTPELGLDEQSVQPWERRTFPLAYSPQAECEEQLDAQDTAARCTRRTSGSKTGREAEVAPTSPPVVPLKSRHLAATVTAQRPAHR
Molecular weight 25.60kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys814-Arg1036
Aliases /Synonyms NSL complex protein NSL1,Non-specific lethal 1 homolog,Kiaa1267, Nsl1
Reference PX-P4737
Note For research use only
Molecular Constructor
Lys814–Arg1036
Product name PX-P4737-1MG
Uniprot ID Q80TG1
Uniprot link https://www.uniprot.org/uniprot/Q80TG1
Expression system Prokaryotic expression
Raw Antigen Sequence KEILTPSWREVDVQSLKGSPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLGSANPSTPQPASPDVSSSHSLSEFSHGQSPRSPISPELHSAPLTPVARDSLRHLASEDTRCSTPELGLDEQSVQPWERRTFPLAYSPQAECEEQLDAQDTAARCTRRTSGSKTGREAEVAPTSPPVVPLKSRHLAATVTAQRPAHR
Molecular weight 25.60kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys814-Arg1036
Aliases /Synonyms NSL complex protein NSL1,Non-specific lethal 1 homolog,Kiaa1267, Nsl1
Reference PX-P4737
Note For research use only
Molecular Constructor
Lys814–Arg1036

General Information on KAT8 regulatory NSL complex subunit 1(Kansl1):

As part of the NSL complex, it is involved in the acetylation of nucleosomal histone H4 in various lysed residues, so it may be involved in the regulation of transcription.nKANSL1 (subunit 1 of the NSL regulatory complex of KAT8) is a gene encoding the protein. Diseases associated with KANSL1 include Cullen-De Vries syndrome and Cullen-De Vries syndrome, caused by mutations in the puncture. Related pathways include the organization of chromatin and the pathway of adenoid cystic carcinoma. The genetic ontology (GO) annotations related to this gene include the activity of histone acetyltransferase (specificity of H4-K5) and the activity of histone acetyltransferase (specificity of H4-K16). The important counterpart of this gene is KANSL1L.

KAT8 regulatory NSL complex subunit 1(Kansl1)

There are no reviews yet.

Be the first to review “KAT8 regulatory NSL complex subunit 1(Kansl1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products