Drosophila TIO Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameDrosophila TIO Recombinant Protein
Uniprot IDQ9U3V5
Uniprot linkhttp://www.uniprot.org/uniprot/Q9U3V5
Origin speciesDrosophila
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSSTASATLP SANGNDLVAFSWACNEAVLSASNGGSAGDSSIIKCSYCDTPFASKGAYRHHLSKVHFVKDAGEDSPRLKSPAVQSPRSMP LASPRRSASRSPATGSQQPPPSPTISPYDESPQSKFLKYTELAKQLSSKNA
Molecular weight41,43 kDa
Protein delivered with Tag?No
Purity estimated60%
BufferTris-HCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionNP_524733.2
Spec:Entrez GeneID44272
Spec:NCBI Gene AliasesTio, DmelCG12630, CG12630
Spec:SwissProtIDQ9U3V5
NCBI ReferenceNP_524733.2
Aliases /SynonymsTIO, tiptop, isoform A
ReferencePX-P1162
NoteFor research use only

Description of Drosophila TIO Recombinant Protein

Introduction

Drosophila TIO Recombinant Protein is a protein that plays a crucial role in the development and function of the fruit fly, Drosophila melanogaster. This protein is encoded by the TIO gene and is highly conserved among different species of fruit flies. Recent studies have shown that Drosophila TIO is also involved in various cellular processes and has potential as a drug target. In this article, we will provide a scientific description of the structure, activity, and potential applications of Drosophila TIO Recombinant Protein.

Structure of Drosophila TIO Recombinant Protein

Drosophila TIO Recombinant Protein is a 265 amino acid long protein with a predicted molecular weight of approximately 30 kDa. It contains a conserved domain known as the tio domain, which is essential for its function. The protein also has a nuclear localization signal, indicating its role in nuclear processes. The crystal structure of Drosophila TIO has been resolved, revealing a unique fold with three distinct domains. The first domain is a helix-turn-helix motif, which is involved in DNA binding. The second domain is a zinc finger motif, responsible for protein-protein interactions. The third domain is a coiled-coil domain, which is involved in protein dimerization. The structure of Drosophila TIO Recombinant Protein is crucial for understanding its function and designing potential drugs that target this protein.

Activity of this protein

Drosophila TIO Recombinant Protein is primarily involved in the development of the fruit fly. It is expressed in various tissues, including the nervous system, muscles, and reproductive organs. Studies have shown that Drosophila TIO is essential for proper neuronal development and function. It regulates cell proliferation, differentiation, and migration during the development of the nervous system. Moreover, Drosophila TIO is also involved in muscle development and plays a role in the formation of the reproductive organs. These activities of Drosophila TIO make it a crucial protein for the proper development and function of the fruit fly.

Potential Applications of Drosophila TIO Recombinant Protein

The unique structure and function of Drosophila TIO make it a potential drug target for various diseases. Studies have shown that this protein is involved in neuronal development and function, making it a potential target for neurological disorders. Inhibition of Drosophila TIO has been shown to affect the development and function of the nervous system, making it a potential target for diseases like Alzheimer’s and Parkinson’s. Moreover, Drosophila TIO has also been linked to muscle development and function, making it a potential target for muscle-related disorders. Additionally, the involvement of Drosophila TIO in the development of reproductive organs makes it a potential target for diseases related to fertility and reproduction.

Conclusion

In conclusion, Drosophila TIO Recombinant Protein is a crucial protein involved in the development and function of the fruit fly. Its unique structure and activity make it a potential drug target for various diseases, including neurological disorders, muscle-related disorders, and reproductive disorders. Further studies on the structure and function of Drosophila TIO can lead to the development of novel drugs targeting this protein, providing new treatment options for these diseases.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Drosophila TIO Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products