Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Drosophila TIO Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Drosophila
Uniprot ID:
Q9U3V5
Molecular weight:
41,43 kDa

$250.00

50ug + 250 loyalty points
Partial No
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Drosophila TIO Recombinant Protein

Product name Drosophila TIO Recombinant Protein
Uniprot ID Q9U3V5
Uniprot link http://www.uniprot.org/uniprot/Q9U3V5
Origin species Drosophila
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSSTASATLP SANGNDLVAFSWACNEAVLSASNGGSAGDSSIIKCSYCDTPFASKGAYRHHLSKVHFVKDAGEDSPRLKSPAVQSPRSMP LASPRRSASRSPATGSQQPPPSPTISPYDESPQSKFLKYTELAKQLSSKNA
Molecular weight 41,43 kDa
Protein delivered with Tag? No
Purity estimated 60%
Buffer Tris-HCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_524733.2
Spec:Entrez GeneID 44272
Spec:NCBI Gene Aliases Tio, DmelCG12630, CG12630
Spec:SwissProtID Q9U3V5
NCBI Reference NP_524733.2
Aliases /Synonyms TIO, tiptop, isoform A
Reference PX-P1162
Note For research use only
Molecular Constructor
Partial No
Product name Drosophila TIO Recombinant Protein
Uniprot ID Q9U3V5
Uniprot link http://www.uniprot.org/uniprot/Q9U3V5
Origin species Drosophila
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSSTASATLP SANGNDLVAFSWACNEAVLSASNGGSAGDSSIIKCSYCDTPFASKGAYRHHLSKVHFVKDAGEDSPRLKSPAVQSPRSMP LASPRRSASRSPATGSQQPPPSPTISPYDESPQSKFLKYTELAKQLSSKNA
Molecular weight 41,43 kDa
Protein delivered with Tag? No
Purity estimated 60%
Buffer Tris-HCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_524733.2
Spec:Entrez GeneID 44272
Spec:NCBI Gene Aliases Tio, DmelCG12630, CG12630
Spec:SwissProtID Q9U3V5
NCBI Reference NP_524733.2
Aliases /Synonyms TIO, tiptop, isoform A
Reference PX-P1162
Note For research use only
Molecular Constructor
Partial No

There are no reviews yet.

Be the first to review “Drosophila TIO Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products