Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pritoxaximab Biosimilar – Anti-shiga toxin type 1 B subunit mAb – Research Grade

  • PX-TA1318-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

Product name Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade
Uniprot ID Q47641
Source CAS 1351470-16-0
Species Chimeric
Raw Antigen Sequence MKKILLIAASLSFFSASVLAAPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pritoxaximab,Shigamabs-(drug name for the combination of pritoxaximab and setoxaximab),caStx1,shiga toxin type 1 B subunit,anti-shiga toxin type 1 B subunit
Reference PX-TA1318
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade
Uniprot ID Q47641
Source CAS 1351470-16-0
Species Chimeric
Raw Antigen Sequence MKKILLIAASLSFFSASVLAAPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pritoxaximab,Shigamabs-(drug name for the combination of pritoxaximab and setoxaximab),caStx1,shiga toxin type 1 B subunit,anti-shiga toxin type 1 B subunit
Reference PX-TA1318
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1318-50
Uniprot ID Q47641
Source CAS 1351470-16-0
Species Chimeric
Raw Antigen Sequence MKKILLIAASLSFFSASVLAAPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pritoxaximab,Shigamabs-(drug name for the combination of pritoxaximab and setoxaximab),caStx1,shiga toxin type 1 B subunit,anti-shiga toxin type 1 B subunit
Reference PX-TA1318
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-shiga toxin type 1 B subunit[Escherichia coli] (Pritoxaximab) Monoclonal Antibody

Pritoxaximab has been investigated for the prevention and treatment of Shiga-like toxin-producing Escherichia coli(STEC) or E. coli serotype O121 infection.

SEC-HPLC of Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

SEC-HPLC of Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

SDS-PAGE for Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

There are no reviews yet.

Be the first to review “Pritoxaximab Biosimilar – Anti-shiga toxin type 1 B subunit mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products