Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Cytochrome c oxidase assembly factor 8(COA8)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q96IL0
Molecular weight:
21.3kDa

$250.00

50ug + 250 loyalty points
His Ala40–Asn206
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Cytochrome c oxidase assembly factor 8(COA8)

Cytochrome c oxidase assembly factor 8(COA8)

Product name Cytochrome c oxidase assembly factor 8(COA8)
Uniprot ID Q96IL0
Uniprot link https://www.uniprot.org/uniprot/Q96IL0
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Molecular weight 21.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala40-Asn206
Protein Accession Q96IL0
Spec:Entrez GeneID 84334
Spec:NCBI Gene Aliases APOP; APOP1; APOPT1; MC4DN17; C14orf153
Spec:SwissProtID Q53G28
NCBI Reference Q96IL0
Aliases /Synonyms APOP1, APOPT1,APOP-1,Apoptogenic protein 1, mitochondrial
Reference PX-P4817
Note For research use only
Molecular Constructor
His Ala40–Asn206
Product name Cytochrome c oxidase assembly factor 8(COA8)
Uniprot ID Q96IL0
Uniprot link https://www.uniprot.org/uniprot/Q96IL0
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Molecular weight 21.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala40-Asn206
Protein Accession Q96IL0
Spec:Entrez GeneID 84334
Spec:NCBI Gene Aliases APOP; APOP1; APOPT1; MC4DN17; C14orf153
Spec:SwissProtID Q53G28
NCBI Reference Q96IL0
Aliases /Synonyms APOP1, APOPT1,APOP-1,Apoptogenic protein 1, mitochondrial
Reference PX-P4817
Note For research use only
Molecular Constructor
His Ala40–Asn206

There are no reviews yet.

Be the first to review “Cytochrome c oxidase assembly factor 8(COA8)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products