Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Inhibin alpha chain

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P05111
Molecular weight:
16.35kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
His Ser233–Ile366
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Inhibin alpha chain

Product name Inhibin alpha chain
Uniprot ID P05111
Uniprot link https://www.uniprot.org/uniprot/P05111
Expression system Prokaryotic expression
Raw Antigen Sequence STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI
Molecular weight 16.35kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser233-Ile366
Protein Accession P05111
Spec:Entrez GeneID 3623
Spec:SwissProtID A8K8H5
NCBI Reference P05111
Aliases /Synonyms A-inhibin subunit; INHA; Inhibin A; inhibin alpha chain; inhibin, alpha
Reference PX-P4882
Note For research use only
Molecular Constructor
His Ser233–Ile366
Product name Inhibin alpha chain
Uniprot ID P05111
Uniprot link https://www.uniprot.org/uniprot/P05111
Expression system Prokaryotic expression
Raw Antigen Sequence STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI
Molecular weight 16.35kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser233-Ile366
Protein Accession P05111
Spec:Entrez GeneID 3623
Spec:SwissProtID A8K8H5
NCBI Reference P05111
Aliases /Synonyms A-inhibin subunit; INHA; Inhibin A; inhibin alpha chain; inhibin, alpha
Reference PX-P4882
Note For research use only
Molecular Constructor
His Ser233–Ile366
Product name PX-P4882-1MG
Uniprot ID P05111
Uniprot link https://www.uniprot.org/uniprot/P05111
Expression system Prokaryotic expression
Raw Antigen Sequence STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI
Molecular weight 16.35kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser233-Ile366
Protein Accession P05111
Spec:Entrez GeneID 3623
Spec:SwissProtID A8K8H5
NCBI Reference P05111
Aliases /Synonyms A-inhibin subunit; INHA; Inhibin A; inhibin alpha chain; inhibin, alpha
Reference PX-P4882
Note For research use only
Molecular Constructor
His Ser233–Ile366

Inhibin alpha chain

There are no reviews yet.

Be the first to review “Inhibin alpha chain”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products