Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

DNA-binding protein H-NS (hns)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P0ACF9
Molecular weight:
17.63kDa

$250.00

50ug + 250 loyalty points
Met12–Gln156
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

DNA-binding protein H-NS (hns)

Product name DNA-binding protein H-NS (hns)
Uniprot ID P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight 17.63kDa
Purity estimated 40% by SDS-PAGE
Buffer 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met12-Gln156
Aliases /Synonyms DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference PX-P4380
Note For research use only
Molecular Constructor
Met12–Gln156
Product name DNA-binding protein H-NS (hns)
Uniprot ID P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight 17.63kDa
Purity estimated 40% by SDS-PAGE
Buffer 20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met12-Gln156
Aliases /Synonyms DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference PX-P4380
Note For research use only
Molecular Constructor
Met12–Gln156

There are no reviews yet.

Be the first to review “DNA-binding protein H-NS (hns)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products