Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Blue-light photoreceptor(lmo0799)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P58724
Molecular weight:
29.79kDa

$392.00

100ug + 392 loyalty points
full length
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Blue-light photoreceptor(lmo0799)

Blue-light photoreceptor(lmo0799)

Product name Blue-light photoreceptor(lmo0799)
Uniprot ID P58724
Uniprot link https://www.uniprot.org/uniprot/P58724
Expression system Prokaryotic expression
Sequence MGTAYPQFDVILKALNLSSVGVIITDPEQKDNPIIFVNTGFENITGYAKEEALGSNCHFLQGDDTDKEEVAKIRHAINEK STANVLLKNYRKDGTSFMNELTIEPIYDDHEHLYFVGIQKDVTTEHDYQLELEKSLTEIEKLSTPIVPIKENICVLPLIG SLTHDRFQHMSEYVSEYMDHGKEDYLIMDLSGLAEFNEDAVMNLVKFHGFMKLTGVELIITGISPKFAMTLIRYEENLAS LTTYSTIKEALQFYGSHHHHHH
Molecular weight 29.79kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms Phototropin homolog
Reference PX-P4543
Note For research use only
Molecular Constructor
full length
Product name Blue-light photoreceptor(lmo0799)
Uniprot ID P58724
Uniprot link https://www.uniprot.org/uniprot/P58724
Expression system Prokaryotic expression
Sequence MGTAYPQFDVILKALNLSSVGVIITDPEQKDNPIIFVNTGFENITGYAKEEALGSNCHFLQGDDTDKEEVAKIRHAINEK STANVLLKNYRKDGTSFMNELTIEPIYDDHEHLYFVGIQKDVTTEHDYQLELEKSLTEIEKLSTPIVPIKENICVLPLIG SLTHDRFQHMSEYVSEYMDHGKEDYLIMDLSGLAEFNEDAVMNLVKFHGFMKLTGVELIITGISPKFAMTLIRYEENLAS LTTYSTIKEALQFYGSHHHHHH
Molecular weight 29.79kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms Phototropin homolog
Reference PX-P4543
Note For research use only
Molecular Constructor
full length

There are no reviews yet.

Be the first to review “Blue-light photoreceptor(lmo0799)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products