Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Ribosomal RNA small subunit methyltransferase H(rsmH)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
B4TXH0
Molecular weight:
35.96kDa

$392.00

100ug + 392 loyalty points
full length
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Ribosomal RNA small subunit methyltransferase H(rsmH)

Ribosomal RNA small subunit methyltransferase H(rsmH)

Product name Ribosomal RNA small subunit methyltransferase H(rsmH)
Uniprot ID B4TXH0
Uniprot link http://www.uniprot.org/uniprot/B4TXH0
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQLGEEGRLLAIDRDPQAIAVAQTIND PRFSIIHGPFSALADYVAERELTGKIDGILLDLGVSSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIA WVLKTFGEERFAKRIARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQALKSSLSV LAPGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKLGGRELRALGKLMPGEKEVAENPRARSSVLRIAE RTNA
Molecular weight 35.96kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms 16S rRNA m(4)C1402 methyltransferase, rRNA (cytosine-N(4)-)-methyltransferase RsmH
Reference PX-P4517
Note For research use only
Molecular Constructor
full length
Product name Ribosomal RNA small subunit methyltransferase H(rsmH)
Uniprot ID B4TXH0
Uniprot link http://www.uniprot.org/uniprot/B4TXH0
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQLGEEGRLLAIDRDPQAIAVAQTIND PRFSIIHGPFSALADYVAERELTGKIDGILLDLGVSSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIA WVLKTFGEERFAKRIARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQALKSSLSV LAPGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKLGGRELRALGKLMPGEKEVAENPRARSSVLRIAE RTNA
Molecular weight 35.96kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms 16S rRNA m(4)C1402 methyltransferase, rRNA (cytosine-N(4)-)-methyltransferase RsmH
Reference PX-P4517
Note For research use only
Molecular Constructor
full length

There are no reviews yet.

Be the first to review “Ribosomal RNA small subunit methyltransferase H(rsmH)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products