Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Glycogen synthase kinase-3 beta(GSK3B)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P49841
Molecular weight:
47kDa

Original price was: $267.00.Current price is: $217.00.

50ug 19% OFF + 217 loyalty points
GST Met1–Thr420
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Glycogen synthase kinase-3 beta(GSK3B)

Product name Glycogen synthase kinase-3 beta(GSK3B)
Uniprot ID P49841
Uniprot link https://www.uniprot.org/uniprot/P49841
Expression system Prokaryotic expression
Raw Antigen Sequence MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Molecular weight 47kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr420
Protein Accession P49841
Spec:Entrez GeneID 2932
Spec:SwissProtID Q9BWH3
NCBI Reference P49841
Aliases /Synonyms GSK-3 beta,Serine/threonine-protein kinase GSK3B
Reference PX-P4662
Note For research use only
Molecular Constructor
GST Met1–Thr420
Product name Glycogen synthase kinase-3 beta(GSK3B)
Uniprot ID P49841
Uniprot link https://www.uniprot.org/uniprot/P49841
Expression system Prokaryotic expression
Raw Antigen Sequence MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Molecular weight 47kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr420
Protein Accession P49841
Spec:Entrez GeneID 2932
Spec:SwissProtID Q9BWH3
NCBI Reference P49841
Aliases /Synonyms GSK-3 beta,Serine/threonine-protein kinase GSK3B
Reference PX-P4662
Note For research use only
Molecular Constructor
GST Met1–Thr420
Product name PX-P4662-1MG
Uniprot ID P49841
Uniprot link https://www.uniprot.org/uniprot/P49841
Expression system Prokaryotic expression
Raw Antigen Sequence MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Molecular weight 47kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr420
Protein Accession P49841
Spec:Entrez GeneID 2932
Spec:SwissProtID Q9BWH3
NCBI Reference P49841
Aliases /Synonyms GSK-3 beta,Serine/threonine-protein kinase GSK3B
Reference PX-P4662
Note For research use only
Molecular Constructor
GST Met1–Thr420

Glycogen synthase kinase-3 beta(GSK3B)

There are no reviews yet.

Be the first to review “Glycogen synthase kinase-3 beta(GSK3B)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products