Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Creatine kinase MB(CKMB)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P06732&P12277
Molecular weight:
45kDa & 45kDa

$250.00

50ug + 250 loyalty points
His Met1–Lys381 CKM&CKB Strep
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Creatine kinase MB(CKMB)

Creatine kinase MB(CKMB)

Product name Creatine kinase MB(CKMB)
Uniprot ID P06732&P12277
Uniprot link https://www.uniprot.org/uniprot/P06732
Expression system Prokaryotic expression
Sequence MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK & MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQKL
Molecular weight 45kDa & 45kDa
Protein delivered with Tag? C-terminal Strep tag & N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type CKM(Met1-Lys381)&CKB(Met1-Lys381)
Protein Accession P06732&P12277
Spec:Entrez GeneID 1158&1152
Spec:NCBI Gene Aliases CKMM; M-CK; CPK-M
Spec:SwissProtID Q96QL9&Q2LE07
NCBI Reference P06732&P12277
Aliases /Synonyms CKMB,Creatine kinase M chain;Creatine phosphokinase M-typeCurated;CPK-M;M-CK & Brain creatine kinase1 Publication;B-CK;Creatine kinase B chain1 Publication;Creatine phosphokinase B-type;CPK-B
Reference PX-P4572
Note For research use only
Molecular Constructor
His Met1–Lys381 CKM&CKB Strep
Product name Creatine kinase MB(CKMB)
Uniprot ID P06732&P12277
Uniprot link https://www.uniprot.org/uniprot/P06732
Expression system Prokaryotic expression
Sequence MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK & MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQKL
Molecular weight 45kDa & 45kDa
Protein delivered with Tag? C-terminal Strep tag & N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type CKM(Met1-Lys381)&CKB(Met1-Lys381)
Protein Accession P06732&P12277
Spec:Entrez GeneID 1158&1152
Spec:NCBI Gene Aliases CKMM; M-CK; CPK-M
Spec:SwissProtID Q96QL9&Q2LE07
NCBI Reference P06732&P12277
Aliases /Synonyms CKMB,Creatine kinase M chain;Creatine phosphokinase M-typeCurated;CPK-M;M-CK & Brain creatine kinase1 Publication;B-CK;Creatine kinase B chain1 Publication;Creatine phosphokinase B-type;CPK-B
Reference PX-P4572
Note For research use only
Molecular Constructor
His Met1–Lys381 CKM&CKB Strep

There are no reviews yet.

Be the first to review “Creatine kinase MB(CKMB)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products