Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Ade2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P22234
Molecular weight:
48,40 kDa

Original price was: $318.00.Current price is: $250.00.

50ug 21% OFF + 250 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Ade2 Recombinant Protein

Product name Human Ade2 Recombinant Protein
Uniprot ID P22234
Uniprot link http://www.uniprot.org/uniprot/P22234
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Molecular weight 48,40 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, 20% glycerol, 0,05% sodium azide
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_006443.1
Spec:Entrez GeneID 10606
Spec:NCBI Gene Aliases PAIS, AIRC, ADE2H1, ADE2
Spec:SwissProtID P22234
NCBI Reference NP_006443.1
Aliases /Synonyms Ade2, multifunctional protein ADE2 isoform 2
Reference PX-P1066
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Ade2 Recombinant Protein
Uniprot ID P22234
Uniprot link http://www.uniprot.org/uniprot/P22234
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Molecular weight 48,40 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, 20% glycerol, 0,05% sodium azide
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_006443.1
Spec:Entrez GeneID 10606
Spec:NCBI Gene Aliases PAIS, AIRC, ADE2H1, ADE2
Spec:SwissProtID P22234
NCBI Reference NP_006443.1
Aliases /Synonyms Ade2, multifunctional protein ADE2 isoform 2
Reference PX-P1066
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1066-1MG
Uniprot ID P22234
Uniprot link http://www.uniprot.org/uniprot/P22234
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Molecular weight 48,40 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, 20% glycerol, 0,05% sodium azide
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_006443.1
Spec:Entrez GeneID 10606
Spec:NCBI Gene Aliases PAIS, AIRC, ADE2H1, ADE2
Spec:SwissProtID P22234
NCBI Reference NP_006443.1
Aliases /Synonyms Ade2, multifunctional protein ADE2 isoform 2
Reference PX-P1066
Note For research use only
Molecular Constructor
Full-length Yes

Human Ade2 Recombinant Protein

There are no reviews yet.

Be the first to review “Human Ade2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products