Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O75874
Molecular weight:
46.67 kDa

$169.00

100ug + 169 loyalty points
His Met1–Leu414
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)

Product name Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)
Uniprot ID O75874
Uniprot link https://www.uniprot.org/uniprot/O75874
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVK CATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDF VVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTIL KKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSL GMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL*
Molecular weight 46.67 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu414
Protein Accession O75874
Spec:Entrez GeneID 3417
Spec:NCBI Gene Aliases IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26
Spec:SwissProtID Q567U4
NCBI Reference O75874
Aliases /Synonyms IDH,Cytosolic NADP-isocitrate dehydrogenase,IDP,NADP(+)-specific ICDH,Oxalosuccinate decarboxylase
Reference PX-P4779
Note For research use only
Molecular Constructor
His Met1–Leu414
Product name Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)
Uniprot ID O75874
Uniprot link https://www.uniprot.org/uniprot/O75874
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVK CATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDF VVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTIL KKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSL GMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL*
Molecular weight 46.67 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu414
Protein Accession O75874
Spec:Entrez GeneID 3417
Spec:NCBI Gene Aliases IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26
Spec:SwissProtID Q567U4
NCBI Reference O75874
Aliases /Synonyms IDH,Cytosolic NADP-isocitrate dehydrogenase,IDP,NADP(+)-specific ICDH,Oxalosuccinate decarboxylase
Reference PX-P4779
Note For research use only
Molecular Constructor
His Met1–Leu414

Introduction to Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)

Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1) is an enzyme that plays a crucial role in cellular metabolism. It is found in the cytoplasm of cells and is responsible for the conversion of isocitrate to alpha-ketoglutarate in the presence of NADP+. This reaction is a key step in the citric acid cycle, which is the primary metabolic pathway for generating energy in the form of ATP.

Structure of IDH1

IDH1 is a protein that is composed of 414 amino acids and has a molecular weight of approximately 46 kDa. It is a homodimer, meaning it is made up of two identical subunits, each containing an active site. The active site of IDH1 consists of a conserved Arg-Ser-Asp motif, which is essential for its catalytic activity.

The crystal structure of IDH1 has been extensively studied, and it has been found to belong to the isocitrate and isopropylmalate dehydrogenase superfamily. This superfamily includes enzymes that are involved in various biological processes, such as amino acid biosynthesis, fatty acid metabolism, and the citric acid cycle.

Activity of this protein

IDH1 is primarily involved in the conversion of isocitrate to alpha-ketoglutarate in the presence of NADP+. This reaction is a key step in the citric acid cycle, which is the primary metabolic pathway for generating energy in the form of ATP.

Apart from its role in the citric acid cycle, IDH1 has also been found to have other functions. It has been shown to play a role in the regulation of cellular redox balance by producing NADPH, which is an important antioxidant. Additionally, IDH1 has been found to be involved in the production of nucleotide precursors, which are essential for DNA and RNA synthesis.

Role of IDH1 as a Drug Target

Due to its crucial role in cellular metabolism, IDH1 has been identified as a potential drug target for various diseases. Mutations in the IDH1 gene have been linked to several types of cancer, including gliomas, acute myeloid leukemia, and cholangiocarcinoma. These mutations lead to a gain of function in IDH1, resulting in the production of an oncometabolite, which promotes tumorigenesis.

As a result, there has been a significant effort to develop inhibitors of IDH1 as potential cancer therapeutics. Several small molecule inhibitors have been developed, which have shown promising results in preclinical studies. These inhibitors target the active site of IDH1 and prevent its catalytic activity, thereby inhibiting the production of the oncometabolite.

Application of IDH1 in Research

Apart from its potential as a drug target, IDH1 has also been extensively studied in research. Its role in cellular metabolism and redox balance makes it a crucial enzyme for understanding various diseases, including cancer, neurodegenerative disorders, and metabolic disorders.

IDH1 has also been used as a biomarker for disease diagnosis and prognosis. Mutations in the IDH1 gene have been found to be present in a large percentage of patients with certain types of cancer, making it a potential diagnostic marker. Additionally, the expression levels of IDH1 have been correlated with disease progression and patient outcomes in various cancers.

Conclusion

In summary, Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1) is a crucial enzyme involved in cellular metabolism. Its structure, activity, and potential as a drug target have been extensively studied, and it has been found to play a crucial role in various diseases, particularly cancer.

There are no reviews yet.

Be the first to review “Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products