Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Leishmania CPB Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Leishmania
Uniprot ID:
A4HTP0
Molecular weight:
18,82 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Leishmania CPB Recombinant Protein

Leishmania CPB Recombinant Protein

Product name Leishmania CPB Recombinant Protein
Uniprot ID A4HTP0
Uniprot link http://www.uniprot.org/uniprot/A4HTP0
Origin species Leishmania
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRTYRRAYGTLAEEQQRLANFERNLELM REHQARNPHARFGITKFFDLSEAEFAARYLNGAAYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKDQGACGS CWAFSAVGNIE
Molecular weight 18,82 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_001463431.1
Spec:Entrez GeneID 5066816
Spec:SwissProtID A4HTP0
NCBI Reference XP_001463431.1
Aliases /Synonyms CPB, Cathepsin L-like Protease
Reference PX-P1082
Note For research use only
Molecular Constructor
Partial Yes
Product name Leishmania CPB Recombinant Protein
Uniprot ID A4HTP0
Uniprot link http://www.uniprot.org/uniprot/A4HTP0
Origin species Leishmania
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRTYRRAYGTLAEEQQRLANFERNLELM REHQARNPHARFGITKFFDLSEAEFAARYLNGAAYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKDQGACGS CWAFSAVGNIE
Molecular weight 18,82 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_001463431.1
Spec:Entrez GeneID 5066816
Spec:SwissProtID A4HTP0
NCBI Reference XP_001463431.1
Aliases /Synonyms CPB, Cathepsin L-like Protease
Reference PX-P1082
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Leishmania CPB Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products