Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P0A0Z8
Molecular weight:
26.86kDa

Original price was: $282.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
Met1–Ser228
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag

Product name N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag
Uniprot ID P0A0Z8
Uniprot link https://www.uniprot.org/uniprot/P0A0Z8
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.86kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS pH7.5+10%Glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms siaB, synB, CMP-N-acetylneuraminic acid synthase,CMP-NeuNAc synthase,CMP-sialic acid synthase
Reference PX-P4319
Note For research use only
Molecular Constructor
Met1–Ser228
Product name N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag
Uniprot ID P0A0Z8
Uniprot link https://www.uniprot.org/uniprot/P0A0Z8
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.86kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS pH7.5+10%Glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms siaB, synB, CMP-N-acetylneuraminic acid synthase,CMP-NeuNAc synthase,CMP-sialic acid synthase
Reference PX-P4319
Note For research use only
Molecular Constructor
Met1–Ser228
Product name PX-P4319-1MG
Uniprot ID P0A0Z8
Uniprot link https://www.uniprot.org/uniprot/P0A0Z8
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.86kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS pH7.5+10%Glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms siaB, synB, CMP-N-acetylneuraminic acid synthase,CMP-NeuNAc synthase,CMP-sialic acid synthase
Reference PX-P4319
Note For research use only
Molecular Constructor
Met1–Ser228

N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag

There are no reviews yet.

Be the first to review “N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products