Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Protein A, von Willebrand factor binding protein Spa(spa)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A098GZT2 or P38507
Molecular weight:
38.33kDa

$250.00

50ug + 250 loyalty points
Met1~Lys327
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Protein A, von Willebrand factor binding protein Spa(spa)

Protein A, von Willebrand factor binding protein Spa(spa)

Product name Protein A, von Willebrand factor binding protein Spa(spa)
Uniprot ID A0A098GZT2 or P38507
Uniprot link http://www.uniprot.org/uniprot/A0A098GZT2
Expression system Prokaryotic expression
Sequence MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 38.33kDa
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A
Reference PX-P4556
Note For research use only
Molecular Constructor
Met1~Lys327
Product name Protein A, von Willebrand factor binding protein Spa(spa)
Uniprot ID A0A098GZT2 or P38507
Uniprot link http://www.uniprot.org/uniprot/A0A098GZT2
Expression system Prokaryotic expression
Sequence MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 38.33kDa
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A
Reference PX-P4556
Note For research use only
Molecular Constructor
Met1~Lys327

There are no reviews yet.

Be the first to review “Protein A, von Willebrand factor binding protein Spa(spa)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products