Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

NADPH oxidase 4(NOX4) (210-424)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9NPH5
Molecular weight:
24.81 kDa

Original price was: $250.00.Current price is: $218.00.

50ug 13% OFF + 218 loyalty points
His Gly210–Glu424
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

NADPH oxidase 4(NOX4) (210-424)

Product name NADPH oxidase 4(NOX4) (210-424)
Uniprot ID Q9NPH5
Uniprot link https://www.uniprot.org/uniprot/Q9NPH5
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Molecular weight 24.81 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly210-Glu424
Protein Accession Q9NPH5
Spec:Entrez GeneID 50507
Spec:NCBI Gene Aliases KOX; KOX-1; RENOX
Spec:SwissProtID Q86V92
NCBI Reference Q9NPH5
Aliases /Synonyms Kidney oxidase-1,KOX-1,Kidney superoxide-producing NADPH oxidase,Renal NAD(P)H-oxidase,RENOX
Reference PX-P4785
Note For research use only
Molecular Constructor
His Gly210–Glu424
Product name NADPH oxidase 4(NOX4) (210-424)
Uniprot ID Q9NPH5
Uniprot link https://www.uniprot.org/uniprot/Q9NPH5
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Molecular weight 24.81 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly210-Glu424
Protein Accession Q9NPH5
Spec:Entrez GeneID 50507
Spec:NCBI Gene Aliases KOX; KOX-1; RENOX
Spec:SwissProtID Q86V92
NCBI Reference Q9NPH5
Aliases /Synonyms Kidney oxidase-1,KOX-1,Kidney superoxide-producing NADPH oxidase,Renal NAD(P)H-oxidase,RENOX
Reference PX-P4785
Note For research use only
Molecular Constructor
His Gly210–Glu424
Product name PX-P4785-1MG
Uniprot ID Q9NPH5
Uniprot link https://www.uniprot.org/uniprot/Q9NPH5
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Molecular weight 24.81 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly210-Glu424
Protein Accession Q9NPH5
Spec:Entrez GeneID 50507
Spec:NCBI Gene Aliases KOX; KOX-1; RENOX
Spec:SwissProtID Q86V92
NCBI Reference Q9NPH5
Aliases /Synonyms Kidney oxidase-1,KOX-1,Kidney superoxide-producing NADPH oxidase,Renal NAD(P)H-oxidase,RENOX
Reference PX-P4785
Note For research use only
Molecular Constructor
His Gly210–Glu424

NADPH oxidase 4(NOX4) (210-424)

There are no reviews yet.

Be the first to review “NADPH oxidase 4(NOX4) (210-424)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products