Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Drosophila TSH Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Drosophila
Uniprot ID:
P22265
Molecular weight:
46,03 kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
Partial No
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Drosophila TSH Recombinant Protein

Product name Drosophila TSH Recombinant Protein
Uniprot ID P22265
Uniprot link http://www.uniprot.org/uniprot/P22265
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSANSSERCPS HDSNSSEHGGGAGSGGVGHRLDAAALSTGVMPGEGPTTLHSSFPAVPQSLPSQPPSMEAYLHMVAAAAQQYGFPLAAAAA AGAGPRLPLPLANEAAAPFKLPPQASPTASSNNSEALDFRTNLYGRAESAEPPASEGEEEEFDDGANNPLDLSVGTRKRG HESEPQLGHIQVKKMFKSD
Molecular weight 46,03 kDa
Protein delivered with Tag? No
Purity estimated 80%
Buffer 3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAA28983.1
Spec:Entrez GeneID 35430
Spec:NCBI Gene Aliases CG1374, ae, Tsh, T shirt, l(2)B4-2-12, l(2)04319, ae[l], DmelCG1374
Spec:SwissProtID P22265
NCBI Reference AAA28983.1
Aliases /Synonyms TSH, teashirt, Protein teashirt, CG1374
Reference PX-P1054
Note For research use only
Molecular Constructor
Partial No
Product name Drosophila TSH Recombinant Protein
Uniprot ID P22265
Uniprot link http://www.uniprot.org/uniprot/P22265
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSANSSERCPS HDSNSSEHGGGAGSGGVGHRLDAAALSTGVMPGEGPTTLHSSFPAVPQSLPSQPPSMEAYLHMVAAAAQQYGFPLAAAAA AGAGPRLPLPLANEAAAPFKLPPQASPTASSNNSEALDFRTNLYGRAESAEPPASEGEEEEFDDGANNPLDLSVGTRKRG HESEPQLGHIQVKKMFKSD
Molecular weight 46,03 kDa
Protein delivered with Tag? No
Purity estimated 80%
Buffer 3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAA28983.1
Spec:Entrez GeneID 35430
Spec:NCBI Gene Aliases CG1374, ae, Tsh, T shirt, l(2)B4-2-12, l(2)04319, ae[l], DmelCG1374
Spec:SwissProtID P22265
NCBI Reference AAA28983.1
Aliases /Synonyms TSH, teashirt, Protein teashirt, CG1374
Reference PX-P1054
Note For research use only
Molecular Constructor
Partial No
Product name PX-P1054-1MG
Uniprot ID P22265
Uniprot link http://www.uniprot.org/uniprot/P22265
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSANSSERCPS HDSNSSEHGGGAGSGGVGHRLDAAALSTGVMPGEGPTTLHSSFPAVPQSLPSQPPSMEAYLHMVAAAAQQYGFPLAAAAA AGAGPRLPLPLANEAAAPFKLPPQASPTASSNNSEALDFRTNLYGRAESAEPPASEGEEEEFDDGANNPLDLSVGTRKRG HESEPQLGHIQVKKMFKSD
Molecular weight 46,03 kDa
Protein delivered with Tag? No
Purity estimated 80%
Buffer 3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAA28983.1
Spec:Entrez GeneID 35430
Spec:NCBI Gene Aliases CG1374, ae, Tsh, T shirt, l(2)B4-2-12, l(2)04319, ae[l], DmelCG1374
Spec:SwissProtID P22265
NCBI Reference AAA28983.1
Aliases /Synonyms TSH, teashirt, Protein teashirt, CG1374
Reference PX-P1054
Note For research use only
Molecular Constructor
Partial No

General information on Drosophila TSH Recombinant Protein:

Protein teashirt from Drosophila melanogaster (Fruit fly) also known as TSH is initially localized in the cytoplasm soon after the blastoderm stage, and becomes nuclear by stage 9. It belongs to the teashirt C2H2-type zinc-finger protein family. It is a homeotic protein that acts downstream of Arm in the Wg cascade during embryogenesis to determine segment identity throughout the entire trunk. The protein shows a dynamic expression pattern during embryogenesis, expressed throughout embryonic, larval and adult development. TSH may play a role in wing hinge development. Possible involvement in chromatin structure for modulation of transcription. Binds DNA and can act as both a transcriptional repressor and activator.

Drosophila TSH Recombinant Protein

  • Fasano L, Röder L, Coré N, Alexandre E, Vola C, Jacq B, Kerridge S. The gene teashirt is required for the development of Drosophila embryonic trunk segments and encodes a protein with widely spaced zinc finger motifs. Cell. 1991 Jan 11;64(1):63-79. PubMed PMID: 1846092.

There are no reviews yet.

Be the first to review “Drosophila TSH Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products