Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Enteropeptidase（TMPRSS15）

Host species:
Escherichia coli (E.coli)
Origin species:
Bos taurus
Uniprot ID:
P98072

100ug | 50ug
Lys800–His1035 His

This product is currently out of stock and unavailable.

  • Out of Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Enteropeptidase（TMPRSS15）

Enteropeptidase（TMPRSS15）

Product name Enteropeptidase（TMPRSS15）
Uniprot ID P98072
Origin species Bos taurus
Expression system Prokaryotic expression
Raw Antigen Sequence KIVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys800-His1035
Aliases /Synonyms Enterokinase，Serine protease 7，Transmembrane protease serine 15，ENTK, PRSS7
Reference PX-P4684
Note For research use only
Molecular Constructor
Lys800–His1035 His

Enteropeptidase（TMPRSS15）

There are no reviews yet.

Be the first to review “Enteropeptidase（TMPRSS15）”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products