Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human Resistin-like alpha (HIMF) Recombinant Protein |
|---|---|
| Uniprot ID | Q9BQ08 |
| Uniprot link | http://www.uniprot.org/uniprot/Q9BQ08 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLSLEVLFQGPDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Molecular weight | 36 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 85% |
| Buffer | Tris-HCl 0.1M, Glycine 0.1M, pH8.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| NCBI Reference | Q9BQ08 |
| Aliases /Synonyms | Resistin-like beta, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, RELMbeta |
| Reference | PX-P3011 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.