Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human SLC3A1 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human SLC3A1 Recombinant Protein |
|---|---|
| Uniprot ID | Q07837 |
| Uniprot link | http://www.uniprot.org/uniprot/Q07837 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | GNQYVNVMNMLLFTLPGTPITYYGEEIGMGNIVAANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVNVDVQKTQPRSALKLYQDLSLLHANELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFGESTLLNL |
| Molecular weight | 33.88 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% |
| Buffer | PBS,pH 7.5 urea +8M |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| NCBI Reference | Q07837 |
| Aliases /Synonyms | SLC3A1, ATR1, CSNU1, D2H, RBAT, Solute Carrier Family 3 Member 1,Cystine,Dibasic And Neutral Amino Acid Transporters,Activator,Dibasic And Neutral Amino Acid Transport |
| Reference | PX-P3049 |
| Note | For research use only |
Related products
Biosimilar
4F2Mab Biosimilar – Anti-ganglioside GD2, SFRP1, SLC3A2 mAb – Research Grade
PX-TA1073 238$
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.