Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein |
|---|---|
| Uniprot ID | Q14508 |
| Uniprot link | http://www.uniprot.org/uniprot/Q14508 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFGSHHHHHH |
| Molecular weight | 13.96 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 95% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| NCBI Reference | Q14508 |
| Aliases /Synonyms | WFDC2, HE4, WAP5, EDDM4, Epididymal Protein 4, Epididymal Secretory Protein E4, Putative Protease Inhibitor WAP5, Major epididymis-specific protein E4 |
| Reference | PX-P3010 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.