Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | IGFBP1 protein - Human IGFBP1 full length Recombinant Protein |
|---|---|
| Uniprot ID | P08833 |
| Uniprot link | http://www.uniprot.org/uniprot/P08833 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF |
| Molecular weight | 28.74kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 95% |
| Buffer | PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5% |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Protein Accession | ACO37638.1 |
| Spec:Entrez GeneID | 3484 |
| Spec:NCBI Gene Aliases | hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25 |
| Spec:SwissProtID | P08833 |
| NCBI Reference | ACO37638.1 |
| Aliases /Synonyms | IGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1 |
| Reference | PX-P2077 |
| Note | For research use only |
ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein, on SDS-PAGE under reducing
Send us a message from the form below
Reviews
There are no reviews yet.