Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Interleukin-8(CXCL8)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Interleukin-8(CXCL8) |
|---|---|
| Uniprot ID | P10145 |
| Uniprot link | https://www.uniprot.org/uniprot/P10145 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Molecular weight | 50-55kDa |
| Protein delivered with Tag? | C-terminal Fc Tag |
| Purity estimated | >66% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Ala23- Ser99 |
| Protein Accession | P10145 |
| Spec:Entrez GeneID | 3576 |
| Spec:NCBI Gene Aliases | IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8 |
| Spec:SwissProtID | B2R4L8 |
| NCBI Reference | P10145 |
| Aliases /Synonyms | IL8 |
| Reference | PX-P4560 |
| Note | For research use only |
Related products
Biosimilar
ABX-IL8 Biosimilar – Anti-IL8 mAb – Research Grade
PX-TA1119 238$
Biosimilar
9-77 Biosimilar – Anti-IL-8 mAb – Research Grade
PX-TA1618 238$
Tag Antibody
Anti human IgG Fc tag mouse monoclonal antibody
PTX17868 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.