Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein |
|---|---|
| Uniprot ID | Q6A601 |
| Uniprot link | http://www.uniprot.org/uniprot/Q6A601 |
| Origin species | Propionibacterium acnes |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLATSPGDIHPLVQAAHSPDGIPGNGVGPEFHTSSMARSYSEKHLGVAPRGVNDFSCKVKPGDRPVILIPG TGGNAFATWSFYGPHLAHEGYCVYTFTTNVPVGILDEGWGFTGDVRASAQALGAFVDRVRKATGSEKVDFVGHSQGGGIL PNAYIKMYGGASKVDKLIGLVAANHGTTAVGLDKLVDGLPEAVKDFLSTWSYDHNMEAYGQQLKGSALMQQVYRDGDTVP GIAYTVISTRLDMTVTPYTQAFLKGAKNMTVQDACPLDAYGHGRLPYDPVAYQMVLNALDPNHPREISCTWRPRVLPVST TDAA |
| Molecular weight | 34,73 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | >95% |
| Buffer | PBS pH7.5, DTT 1mM, 0.5mM Zwittergent 3-14 and 10% Glycerol if refolding. PBS, Urea 8M if denaturing conditions |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | Lipase protein is stored:At 4°C for short term period (less than a week) At -20°C or -80°C for long term period RecommendationsIt is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | YP_056770.1 |
| Spec:Entrez GeneID | 2932970 |
| Spec:SwissProtID | Q6A601 |
| NCBI Reference | YP_056770.1 |
| Aliases /Synonyms | LIPASE, triacylglycerol lipase precursor |
| Reference | PX-P1121 |
| Note | For research use only |
Propionibacterium acnes lipase is a protein secreted by the Propionibacterium acnes which is a gram-positive anaerobic bacterium. This lipase protein metabolizes sebum which in turn results into metabolites that are responsible for the human skin condition known as acne vulgaris. It is also believed that lipase overexpression increases follicular development.
Propionibacterium acnes lipase protein acts on triglycerides to release free fatty acids. Among the fatty acids released, Palmitic acid stimulates the toll-like receptor 2-mediated inflammasome. The latter is associated with the release of interleukin-1, Th17 differenciation and interleukin-17-mediated keratinocyte proliferation. Oleic acid, another fatty acid released stimulates adhesion and keratinocyte proliferation in Propionibacterium acnes, also via the release of interleukin-1.
Antifugal drug ketoconazole has been suggested to inhibit P.acnes lipase activity. However, the mechanism by which ketoconazole inhibits P.acnes lipase protein remains unknown.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.