Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Propionibacterium acnes
Uniprot ID:
Q6A601
Molecular weight:
34,73 kDa

Original price was: $307.00.Current price is: $250.00.

50ug 19% OFF + 250 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein

Product name Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein
Uniprot ID Q6A601
Uniprot link http://www.uniprot.org/uniprot/Q6A601
Origin species Propionibacterium acnes
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLATSPGDIHPLVQAAHSPDGIPGNGVGPEFHTSSMARSYSEKHLGVAPRGVNDFSCKVKPGDRPVILIPG TGGNAFATWSFYGPHLAHEGYCVYTFTTNVPVGILDEGWGFTGDVRASAQALGAFVDRVRKATGSEKVDFVGHSQGGGIL PNAYIKMYGGASKVDKLIGLVAANHGTTAVGLDKLVDGLPEAVKDFLSTWSYDHNMEAYGQQLKGSALMQQVYRDGDTVP GIAYTVISTRLDMTVTPYTQAFLKGAKNMTVQDACPLDAYGHGRLPYDPVAYQMVLNALDPNHPREISCTWRPRVLPVST TDAA
Molecular weight 34,73 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS pH7.5, DTT 1mM, 0.5mM Zwittergent 3-14 and 10% Glycerol if refolding. PBS, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition

Lipase protein is stored:


At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

Recommendations


It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession YP_056770.1
Spec:Entrez GeneID 2932970
Spec:SwissProtID Q6A601
NCBI Reference YP_056770.1
Aliases /Synonyms LIPASE, triacylglycerol lipase precursor
Reference PX-P1121
Note For research use only
Molecular Constructor
Partial Yes
Product name Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein
Uniprot ID Q6A601
Uniprot link http://www.uniprot.org/uniprot/Q6A601
Origin species Propionibacterium acnes
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLATSPGDIHPLVQAAHSPDGIPGNGVGPEFHTSSMARSYSEKHLGVAPRGVNDFSCKVKPGDRPVILIPG TGGNAFATWSFYGPHLAHEGYCVYTFTTNVPVGILDEGWGFTGDVRASAQALGAFVDRVRKATGSEKVDFVGHSQGGGIL PNAYIKMYGGASKVDKLIGLVAANHGTTAVGLDKLVDGLPEAVKDFLSTWSYDHNMEAYGQQLKGSALMQQVYRDGDTVP GIAYTVISTRLDMTVTPYTQAFLKGAKNMTVQDACPLDAYGHGRLPYDPVAYQMVLNALDPNHPREISCTWRPRVLPVST TDAA
Molecular weight 34,73 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS pH7.5, DTT 1mM, 0.5mM Zwittergent 3-14 and 10% Glycerol if refolding. PBS, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition

Lipase protein is stored:


At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

Recommendations


It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession YP_056770.1
Spec:Entrez GeneID 2932970
Spec:SwissProtID Q6A601
NCBI Reference YP_056770.1
Aliases /Synonyms LIPASE, triacylglycerol lipase precursor
Reference PX-P1121
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1121-1MG
Uniprot ID Q6A601
Uniprot link http://www.uniprot.org/uniprot/Q6A601
Origin species Propionibacterium acnes
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLATSPGDIHPLVQAAHSPDGIPGNGVGPEFHTSSMARSYSEKHLGVAPRGVNDFSCKVKPGDRPVILIPG TGGNAFATWSFYGPHLAHEGYCVYTFTTNVPVGILDEGWGFTGDVRASAQALGAFVDRVRKATGSEKVDFVGHSQGGGIL PNAYIKMYGGASKVDKLIGLVAANHGTTAVGLDKLVDGLPEAVKDFLSTWSYDHNMEAYGQQLKGSALMQQVYRDGDTVP GIAYTVISTRLDMTVTPYTQAFLKGAKNMTVQDACPLDAYGHGRLPYDPVAYQMVLNALDPNHPREISCTWRPRVLPVST TDAA
Molecular weight 34,73 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS pH7.5, DTT 1mM, 0.5mM Zwittergent 3-14 and 10% Glycerol if refolding. PBS, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition

Lipase protein is stored:


At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

Recommendations


It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession YP_056770.1
Spec:Entrez GeneID 2932970
Spec:SwissProtID Q6A601
NCBI Reference YP_056770.1
Aliases /Synonyms LIPASE, triacylglycerol lipase precursor
Reference PX-P1121
Note For research use only
Molecular Constructor
Partial Yes

General information on Lipase Protein:

Propionibacterium acnes lipase is a protein secreted by the Propionibacterium acnes which is a gram-positive anaerobic bacterium. This lipase protein metabolizes sebum which in turn results into metabolites that are responsible for the human skin condition known as acne vulgaris. It is also believed that lipase overexpression increases follicular development.
Propionibacterium acnes lipase protein acts on triglycerides to release free fatty acids. Among the fatty acids released, Palmitic acid stimulates the toll-like receptor 2-mediated inflammasome. The latter is associated with the release of interleukin-1, Th17 differenciation and interleukin-17-mediated keratinocyte proliferation. Oleic acid, another fatty acid released stimulates adhesion and keratinocyte proliferation in Propionibacterium acnes, also via the release of interleukin-1.
Antifugal drug ketoconazole has been suggested to inhibit P.acnes lipase activity. However, the mechanism by which ketoconazole inhibits P.acnes lipase protein remains unknown.

Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein

There are no reviews yet.

Be the first to review “Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products