Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Lithostathine-1-beta(REG1B) |
---|---|
Uniprot ID | P48304 |
Uniprot link | https://www.uniprot.org/uniprot/P48304 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | QESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTD DSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN |
Molecular weight | 16.23 kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Gln23-Asn166 |
Protein Accession | P48304 |
Spec:Entrez GeneID | 5968 |
Spec:NCBI Gene Aliases | REGH; REGL; PSPS2; REGI-BETA |
NCBI Reference | P48304 |
Aliases /Synonyms | Pancreatic stone protein 2,PSP-2,Regenerating islet-derived protein 1-beta,REG-1-beta,Regenerating protein I beta,PSPS2, REGL |
Reference | PX-P4781 |
Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.