Name: Meiotic recombination protein REC8 homolog(Rec8)
SKU: PX-P4828-10
Availability: InStock

Size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Escherichia coli (E. coli)
Applications	Elisa, WB

Chromatin and nuclear signaling Cell Biology

Product name	Meiotic recombination protein REC8 homolog(Rec8)
Uniprot ID	Q8C5S7
Uniprot link	https://www.uniprot.org/uniprot/Q8C5S7
Expression system	Prokaryotic expression
Sequence	MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLNVNVVKTCEEILNYVLVRVQPPVAGLPRPRFSLYLSAQLQIGVIRVYFQQCQYLVEDIQHILEHLHRAQLRIRIDMEEADLPSLLLPNCLAMMETLEDAPEPFFGKMSVDPRLPSPFDIPQIRHLLEAATPEKTRKETLPEATPDPRKPDRTLATVQSPEVITLQEAEPIRMLQIEGEQDLPEISRGDLELLIAEKDDAILLEERQRGRLLRQRRASLPLDESREEPRALEGAGLVSALSPPAPAQVEGIQEALPGQVFPPEVQKMTGWEPGALLTEVTPPQELRLPAPPSTEKRLPSLQRPLPRRHRRRQLLFWDKETQISREKFEEQLQTGAHCWEYPVAQPPKRMLTSPAELFRTPTLSGWLPPELLGLWTHCAQVPQRMLRQRPQLETEETVEEERAADEEERRKTEALSEIEVLREAQEPSGPLMLSSELSLEAAEDEKSRTSLIPPEWWAWSEEGQPEPPALPMLPELPEVPMEMPPRPELSSEAVLRAVALKLQANKELDFSSLVPPLSPRKLASRVFY LLLVLSTQKILLVEQQKPYGPLLIRPGPKFP
Molecular weight	67.42kDa
Protein delivered with Tag?	N-terminal GST Tag
Purity estimated	>80% by SDS-PAGE
Buffer	TBS, pH8.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Met1-Pro591
Protein Accession	Q8C5S7
Spec:Entrez GeneID	56739
Spec:NCBI Gene Aliases	mre; mrec; Rec8L1
Spec:SwissProtID	Q3UIN9
NCBI Reference	Q8C5S7
Aliases /Synonyms	Cohesin Rec8p,Mei8, Rec8L1
Reference	PX-P4828
Note	For research use only