Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Meiotic recombination protein REC8 homolog(Rec8) |
---|---|
Uniprot ID | Q8C5S7 |
Uniprot link | https://www.uniprot.org/uniprot/Q8C5S7 |
Expression system | Prokaryotic expression |
Sequence | MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLNVNVVKTCEEILNYVLVRVQPPVAGLPRPRFSLYLSAQLQIGVIRVYFQQCQYLVEDIQHILEHLHRAQLRIRIDMEEADLPSLLLPNCLAMMETLEDAPEPFFGKMSVDPRLPSPFDIPQIRHLLEAATPEKTRKETLPEATPDPRKPDRTLATVQSPEVITLQEAEPIRMLQIEGEQDLPEISRGDLELLIAEKDDAILLEERQRGRLLRQRRASLPLDESREEPRALEGAGLVSALSPPAPAQVEGIQEALPGQVFPPEVQKMTGWEPGALLTEVTPPQELRLPAPPSTEKRLPSLQRPLPRRHRRRQLLFWDKETQISREKFEEQLQTGAHCWEYPVAQPPKRMLTSPAELFRTPTLSGWLPPELLGLWTHCAQVPQRMLRQRPQLETEETVEEERAADEEERRKTEALSEIEVLREAQEPSGPLMLSSELSLEAAEDEKSRTSLIPPEWWAWSEEGQPEPPALPMLPELPEVPMEMPPRPELSSEAVLRAVALKLQANKELDFSSLVPPLSPRKLASRVFY LLLVLSTQKILLVEQQKPYGPLLIRPGPKFP |
Molecular weight | 67.42kDa |
Protein delivered with Tag? | N-terminal GST Tag |
Purity estimated | >80% by SDS-PAGE |
Buffer | TBS, pH8.0 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Met1-Pro591 |
Protein Accession | Q8C5S7 |
Spec:Entrez GeneID | 56739 |
Spec:NCBI Gene Aliases | mre; mrec; Rec8L1 |
Spec:SwissProtID | Q3UIN9 |
NCBI Reference | Q8C5S7 |
Aliases /Synonyms | Cohesin Rec8p,Mei8, Rec8L1 |
Reference | PX-P4828 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.