Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Meiotic recombination protein REC8 homolog(Rec8)

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameMeiotic recombination protein REC8 homolog(Rec8)
Uniprot IDQ8C5S7
Uniprot linkhttps://www.uniprot.org/uniprot/Q8C5S7
Expression systemProkaryotic expression
SequenceMFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLNVNVVKTCEEILNYVLVRVQPPVAGLPRPRFSLYLSAQLQIGVIRVYFQQCQYLVEDIQHILEHLHRAQLRIRIDMEEADLPSLLLPNCLAMMETLEDAPEPFFGKMSVDPRLPSPFDIPQIRHLLEAATPEKTRKETLPEATPDPRKPDRTLATVQSPEVITLQEAEPIRMLQIEGEQDLPEISRGDLELLIAEKDDAILLEERQRGRLLRQRRASLPLDESREEPRALEGAGLVSALSPPAPAQVEGIQEALPGQVFPPEVQKMTGWEPGALLTEVTPPQELRLPAPPSTEKRLPSLQRPLPRRHRRRQLLFWDKETQISREKFEEQLQTGAHCWEYPVAQPPKRMLTSPAELFRTPTLSGWLPPELLGLWTHCAQVPQRMLRQRPQLETEETVEEERAADEEERRKTEALSEIEVLREAQEPSGPLMLSSELSLEAAEDEKSRTSLIPPEWWAWSEEGQPEPPALPMLPELPEVPMEMPPRPELSSEAVLRAVALKLQANKELDFSSLVPPLSPRKLASRVFY LLLVLSTQKILLVEQQKPYGPLLIRPGPKFP
Molecular weight67.42kDa
Protein delivered with Tag?N-terminal GST Tag
Purity estimated>80% by SDS-PAGE
BufferTBS, pH8.0
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeMet1-Pro591
Protein AccessionQ8C5S7
Spec:Entrez GeneID56739
Spec:NCBI Gene Aliasesmre; mrec; Rec8L1
Spec:SwissProtIDQ3UIN9
NCBI ReferenceQ8C5S7
Aliases /SynonymsCohesin Rec8p,Mei8, Rec8L1
ReferencePX-P4828
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Meiotic recombination protein REC8 homolog(Rec8)”

Your email address will not be published. Required fields are marked *

Related products

Meiotic recombination protein REC8 homolog(Rec8)
Ligand

Meiotic recombination protein REC8 homolog(Rec8)

PX-P4828 250$
Anti GST tag mouse monoclonal antibody
Tag Antibody

Anti GST tag mouse monoclonal antibody

PTX17859 215$

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products