Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Mucin-1(Met1-Pro146) |
---|---|
Uniprot ID | P15941 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPGSHHHHHH |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90%by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Pro146 |
Aliases /Synonyms | MUC-1,Breast carcinoma-associated antigen DF3,Cancer antigen 15-3,CA 15-3,Carcinoma-associated mucin,Episialin,H23AG,Krebs von den Lungen-6,KL-6 ,PEMT,Peanut-reactive urinary mucin,PUM,Polymorphic epithelial mucin,PEM,Tumor-associated epithelial membrane antigen,EMA,Tumor-associated mucin ,CD_antigen: CD227 |
Reference | PX-P4728 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.