Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | N-acyl homoserine lactonase(aiiA) |
|---|---|
| Uniprot ID | Q9L8R8 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9L8R8 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYKIIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKPIVFFGHDIEQEKGCKVFPEYI |
| Molecular weight | 29.3kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >80% by SDS-PAGE |
| Buffer | PBS pH7.4, 0.02% NLS, 1mM EDTA, 4% trehalose, 1% mannitol |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-IIe250 |
| Protein Accession | Q9L8R8 |
| NCBI Reference | Q9L8R8 |
| Aliases /Synonyms | AHL-lactonase,Acyl-homoserine lactonase |
| Reference | PX-P4602 |
| Note | For research use only. |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.