Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Oncostatin-M(OSM)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Oncostatin-M(OSM) |
|---|---|
| Uniprot ID | P13725 |
| Uniprot link | https://www.uniprot.org/uniprot/P13725 |
| Expression system | Eukaryotic expression |
| Sequence | MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRGSHHHHHH |
| Molecular weight | 25.8kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Arg221 |
| Protein Accession | P13725 |
| Spec:Entrez GeneID | 5008 |
| Spec:SwissProtID | Q6FHP8 |
| NCBI Reference | P13725 |
| Aliases /Synonyms | OSM |
| Reference | PX-P4680 |
| Note | For research use only |
Related products
Biosimilar
Rosmantuzumab Biosimilar – Anti-RSPO3 mAb – Research Grade
PX-TA1446 238$
Biosimilar
Garetosmab Biosimilar – Anti-INHBA mAb – Research Grade
PX-TA1455 238$
Biosimilar
Isecarosmab Biosimilar – Anti-ADAMTSL5;ALB mAb – Research Grade
PX-TA1850 238$
Receptor
Oncostatin-M-specific receptor subunit beta(OSMR)
PX-P4681 250$
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.