Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Recombinant human VEGF Receptor 1 protein-FLT 1 |
|---|---|
| Uniprot ID | P17948 |
| Uniprot link | http://www.uniprot.org/uniprot/P17948 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIGSHHHHHH |
| Molecular weight | 37.7kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 60%-70% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | EC 2.7.10.1, FLT, FLT 1, Flt-1, FLT1, Fms like tyrosine kinase 1, Fms related tyrosine kinase 1, Fms related tyrosine kinase 1 (vascular endothelial Growth Factor proteins/vascular permeability factor receptor), Fms related tyrosine kinase 1 vascular endothelial Growth Factor proteins/vascular permeability factor receptor, Fms-like tyrosine kinase 1, FRT, Soluble VEGF receptor 1 14, Soluble VEGFR1 variant 2, Soluble VEGFR1 variant 21, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, Vascular endothelial Growth Factor proteins receptor 1, Vascular endothelial Growth Factor proteins vascular permeability factor receptor, Vascular permeability factor receptor, Vascular permeability factor receptor 1, VEGFR 1, VEGFR-1, VEGFR1 |
| Reference | PX-P4058 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.