Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B) |
---|---|
Uniprot ID | Q7LG56 |
Uniprot link | https://www.uniprot.org/uniprot/Q7LG56 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS KDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDT YIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPG LTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEF VADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF |
Molecular weight | 40.74 kDa |
Protein delivered with Tag? | N terminus His tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Met1-Phe351 |
Protein Accession | Q7LG56 |
Spec:Entrez GeneID | 50484 |
Spec:NCBI Gene Aliases | P53R2; MTDPS8A; MTDPS8B |
Spec:SwissProtID | Q17RZ6 |
NCBI Reference | Q7LG56 |
Aliases /Synonyms | TP53-inducible ribonucleotide reductase M2 B,p53-inducible ribonucleotide reductase small subunit 2-like protein,p53R2,P53R2 |
Reference | PX-P4793 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.