Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Schistosoma GST Recombinant Protein |
---|---|
Origin species | Schistosoma |
Expression system | Prokaryotic expression |
Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPGRLER PHRD |
Molecular weight | 28,38 kDa |
Protein delivered with Tag? | No |
Purity estimated | >95% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
Protein Accession | AAB37346.1 |
NCBI Reference | AAB37346.1 |
Aliases /Synonyms | GST, glutathione S-transferase |
Reference | PX-P1103 |
Note | For research use only |
Glutathione S-transferase (GST) is a 28 kDa enzyme initially found in Schistosoma japonicum, but presently isolated from a recombinant E. coli source. It catalyzes the extension of the glutathione thiol group to a suitable electrophilic species. Enzymatic activities are based on the conjugation of reduced glutathione in the presence of a second substrate.
Send us a message from the form below
Reviews
There are no reviews yet.