Cart (0 Items)
Your cart is currently empty.
View Products
              
              
              | Size | 100ug, 50ug  | 
		
|---|---|
| Brand | ProteoGenix  | 
		
| Product type | Recombinant Proteins  | 
		
| Host Species | Escherichia coli (E. coli)  | 
		
| Applications | Elisa, WB  | 
		
| Product name | Schistosoma GST Recombinant Protein | 
|---|---|
| Origin species | Schistosoma | 
| Expression system | Prokaryotic expression | 
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPGRLER PHRD | 
| Molecular weight | 28,38 kDa | 
| Protein delivered with Tag? | No | 
| Purity estimated | >95% | 
| Buffer | PBS, pH 7.5 | 
| Form | Frozen | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | 5-7 | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Escherichia coli (E.coli) | 
| Fragment Type | Full-length | 
| Protein Accession | AAB37346.1 | 
| NCBI Reference | AAB37346.1 | 
| Aliases /Synonyms | GST, glutathione S-transferase | 
| Reference | PX-P1103 | 
| Note | For research use only | 
Glutathione S-transferase (GST) is a 28 kDa enzyme initially found in Schistosoma japonicum, but presently isolated from a recombinant E. coli source. It catalyzes the extension of the glutathione thiol group to a suitable electrophilic species. Enzymatic activities are based on the conjugation of reduced glutathione in the presence of a second substrate.
Send us a message from the form below
Reviews
There are no reviews yet.