Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Staphylococcus AmiCat Recombinant Protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Staphylococcus AmiCat Recombinant Protein |
|---|---|
| Origin species | Staphylococcus |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLASAQPRSVAATPKTSLPKYKPQVNSSINDYIRKNNLKAPKIEEDYTSYFPKYAYRNGVGRPEGIVVHDTANDRSTINGEISYMKNNYQNAFVHAFVDGDRIIETAPTDYLSWGVGAVGNPRFINVEIVHTHDYASFARSMNNYADYAATQLQYYGLKPDSAEYDGNGTVWTHYAVSKYLGGTDHADPHGYLRSHNYSYDQLYDLINEKYLIKMGKVAPWGTQSTTTPTTPSKPTTPSKP |
| Molecular weight | 28.11 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | KFA44079.1 |
| Spec:Entrez GeneID | 1113, 12330922 |
| Spec:NCBI Gene Aliases | CGA |
| Spec:SwissProtID | D9RNW1 |
| NCBI Reference | KFA44079.1 |
| Aliases /Synonyms | AmiCat, chromogranin A (parathyroid secretory protein 1) |
| Reference | PX-P2062 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.