Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Stimulator of interferon genes protein(TMEM173)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Stimulator of interferon genes protein(TMEM173) |
|---|---|
| Uniprot ID | Q86WV6 |
| Uniprot link | https://www.uniprot.org/uniprot/Q86WV6 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDC GVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLE QAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLIS GMEKPLPLRTDFS |
| Molecular weight | 28.4kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >85% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gly138-Ser379 |
| Protein Accession | Q86WV6 |
| Spec:Entrez GeneID | 340061 |
| Spec:NCBI Gene Aliases | ERIS; MITA; MPYS; SAVI; NET23; STING; hMITA; hSTING; TMEM173; STING-beta |
| Spec:SwissProtID | B6EB35 |
| NCBI Reference | Q86WV6 |
| Aliases /Synonyms | Endoplasmic reticulum interferon stimulator,ERIS,Mediator of IRF3 activation,hMITA,Transmembrane protein 173,ERIS,MITA,STING |
| Reference | PX-P4843 |
| Note | For research use only |
Related products
Biosimilar
Barecetamab Biosimilar – Anti-ERBB3 mAb – Research Grade
PX-TA1646 238$
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.