Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Thioredoxin 1(trxA) (Escherichia coli)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Applications | Elisa, WB |
| Product name | Thioredoxin 1(trxA) (Escherichia coli) |
|---|---|
| Uniprot ID | P0AA26 |
| Uniprot link | https://www.uniprot.org/uniprot/P0AA26 |
| Origin species | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Expression system | Prokaryotic expression |
| Sequence | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLALEHHHHHH |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Fragment Type | Met1-Ala110 |
| Protein Accession | P0AA26 |
| Spec:SwissProtID | Q8XAT2 |
| NCBI Reference | P0AA26 |
| Aliases /Synonyms | Trx-1 |
| Reference | PX-P4691 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.