Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Toxoplasma gondii GRA6(43-230)(RH) Recombinant Protein |
|---|---|
| Uniprot ID | Q27003 |
| Uniprot link | http://www.uniprot.org/uniprot/Q27003 |
| Origin species | Toxoplasma gondii |
| Expression system | Prokaryotic expression |
| Sequence | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSL AEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKRHRLIGAVVLAVSVAML TAFFLRRTGRRSPQEPSGDGGGNDAGNNAGNGGNEGRGYGGRGEGGAEDDRRPLHPERVNVFDYAAALEHHHHHH |
| Molecular weight | 24,91 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% native, 80% denatured |
| Buffer | PBS, imidazole 300mM in native conditions. NaH2PO4 100mM, TrisBase 10mM, Urea 8M, imidazole 400mM in denaturig conditions |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | AAC37235.1 |
| Spec:SwissProtID | Q27003 |
| NCBI Reference | AAC37235.1 |
| Aliases /Synonyms | GRA6(43-230)(RH), dense granule antigen, Dense granule protein 6, GRA6, GRA 6, Antigen p32, Protein p33, TG24 |
| Reference | PX-P1097 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.