Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Tumor necrosis factor ligand superfamily member 11(TNFSF11) |
---|---|
Uniprot ID | O14788 |
Uniprot link | https://www.uniprot.org/uniprot/O14788 |
Expression system | Eukaryotic expression |
Sequence | MKHLWFFLLLVAAPRWVLSCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGKDDDDKSRGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
Molecular weight | 46,22kDa |
Protein delivered with Tag? | N-terminal Fc Tag |
Purity estimated | >95% by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Gly136-Asp316 |
Protein Accession | O14788 |
Spec:Entrez GeneID | 8600 |
Spec:NCBI Gene Aliases | ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TNLG6B; TRANCE; hRANKL2 |
Spec:SwissProtID | Q96Q17 |
NCBI Reference | O14788 |
Aliases /Synonyms | CD254 antigen; CD254; ODF; OPGL; OPGLOPTB2; Osteoclast differentiation factor; Osteoprotegerin ligand; RANK L; RANKL; RANKLreceptor activator of nuclear factor kappa B ligand; Receptor activator of nuclear factor kappa-B ligand; sOdf; TNF-related activation-induced cytokine; TNFSF11; TRANCE; TRANCEODFhRANKL2; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11 |
Reference | PX-P4774 |
Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.