Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Tumor necrosis factor ligand superfamily member 11(TNFSF11) |
|---|---|
| Uniprot ID | O14788 |
| Uniprot link | https://www.uniprot.org/uniprot/O14788 |
| Expression system | Eukaryotic expression |
| Sequence | MKHLWFFLLLVAAPRWVLSCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGKDDDDKSRGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Molecular weight | 46,22kDa |
| Protein delivered with Tag? | N-terminal Fc Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Gly136-Asp316 |
| Protein Accession | O14788 |
| Spec:Entrez GeneID | 8600 |
| Spec:NCBI Gene Aliases | ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TNLG6B; TRANCE; hRANKL2 |
| Spec:SwissProtID | Q96Q17 |
| NCBI Reference | O14788 |
| Aliases /Synonyms | CD254 antigen; CD254; ODF; OPGL; OPGLOPTB2; Osteoclast differentiation factor; Osteoprotegerin ligand; RANK L; RANKL; RANKLreceptor activator of nuclear factor kappa B ligand; Receptor activator of nuclear factor kappa-B ligand; sOdf; TNF-related activation-induced cytokine; TNFSF11; TRANCE; TRANCEODFhRANKL2; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11 |
| Reference | PX-P4774 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.