Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Wheat TAGW2 Recombinant Protein |
---|---|
Uniprot ID | E5LBR8 |
Uniprot link | http://www.uniprot.org/uniprot/E5LBR8 |
Origin species | Wheat |
Expression system | Prokaryotic expression |
Sequence | MSYYHHHHHHLESTSLYKKAGFMGNRIGGRRKAGVEERYTRPQGLYEHRDIDQKKLRKLILEAKLAPCYPGADDAAGGDL EECPICFLYYPSLNRSKCCSKGICTECFLQMKPTHTARPTQCPFCKTPNYAVEYRGVKTKEERSIEQFEEQKVIEAQMRV RQQALQDEEDKMKRKQSRCSSSRTIAPTTEVEYRDICSTSYSVPSYQCTQQETECCSSEPSCSAQANMRSFHSRHTRDDN IDMNIEDMMVMEAIWRSIQEQGSIGNPSCGSFMPFEQPTRERQAFVAAPPLEIPHPGGFSCAVAAMAEHQPSSMDFSYMT GSSAFPVFDMFRRPCNIAGGSMGAVESSPDSWSGIAPSCSRREVVREEGECSTDHWSEGAEAGTSYAGSDIVVDAGTMLP LPFADNYSMVASHFRPESIEEQMMYSMAVSLAEAHGRTHSQGLAWL |
Molecular weight | 49,94 kDa |
Purity estimated | 90% |
Buffer | PBS, imidazole 150mM, Urea 4M if denaturing conditions. PBS, imidazole 150mM if renaturation. |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
Protein Accession | ADQ00387.1 |
Spec:SwissProtID | E5LBR8 |
NCBI Reference | ADQ00387.1 |
Aliases /Synonyms | TAGW2, ring E3 ubiquitin ligase, REUL1 |
Reference | PX-P1159 |
Note | For research use only |
Wheat orthologous gene of rice OsGW2 that negatively regulates the grain width and weight in rice. There are three TaGW2 homologs in bread wheat, TaGW2A, TaGW2B, and TaGW2D. The transcript abundance of TaGW2A is negatively associated with the grain width.
Send us a message from the form below
Reviews
There are no reviews yet.