Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Alpha-1-acid glycoprotein 2(ORM2)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Alpha-1-acid glycoprotein 2(ORM2) |
|---|---|
| Uniprot ID | P19652 |
| Uniprot link | https://www.uniprot.org/uniprot/P19652 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQC FYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEA LDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES |
| Molecular weight | 21.65 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gln19-Ser201 |
| Protein Accession | P19652 |
| Spec:Entrez GeneID | 5005 |
| Spec:NCBI Gene Aliases | AGP2; AGP-B; AGP-B' |
| NCBI Reference | P19652 |
| Aliases /Synonyms | AGP 2，Orosomucoid-2，OMD 2，AGP2 |
| Reference | PX-P4780 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.