Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | c-JUN Protein - Transcription factor AP-1(JUN) |
|---|---|
| Uniprot ID | P05412 |
| Uniprot link | https://www.uniprot.org/uniprot/P05412 |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
| Molecular weight | 37.78kDa |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | 0.02% Sarcosyl, PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Phe331 |
| Aliases /Synonyms | Activator protein 1,Proto-oncogene c-Jun,V-jun avian sarcoma virus 17 oncogene homolog,p39 |
| Reference | PX-P4739 |
| Note | For research use only |
C-Jun protein is coded by the JUN gene in humans. This protein, together with c-Fos protein forms the AP-1 transcription factor. Because of its interaction with c-Fos protein, c-Jun protein was initially identified as a Fos-binding protein p39. C-Jun protein is involved in the progression through G1 phase. The role of c-Jun protein is to regulate the activity of cyclin D1 activity which is a Rb kinase. Rb protein is a growth suppressor and is inactivated upon phosphorylation. When c-jun protein is absent, the expression of both p53 and p21 increases which results in cell cycle defects. For this reason, c-jun knockout is lethal. However, transgenic animals that contain c-jun protein that cannot undergo phosphorylation, can survive. In this case cells remain blocked in G1 phase. Upregulation of c-jun protein results in increased cell growth and proliferation which makes c-jun a proto-oncogenic protein.
C-Jun, along with c-Fos protein are highly regulated by different extracellular stimuli such as growth factors, pro-inflammatory cytokines, UV irradiation and oxidative cellular stress. Indeed, increased UV irradiation has been linked to elevated c-jun expression. ERK pathway has also been involved in c-jun expression regulation. Active ERK increases c-jun transcription as well as its stability. The mobilization of c-jun protein leads to the activation of it downstream target RCAK1 which enhances JNK activity. JNK is a kinase that binds to c-jun and double phosphorylates the protein on Ser-63 and Ser-73 of its transcriptional activation domain. Research suggests that the phosphorylation of c-jun protein on threonine 91 and 93 triggers c-jun pro-apoptotic activity . According to Ce et al., (2013) the phosphorylation of c-Jun at threonine 91 and threonine 93 is dependent of threonine 95 which suggested the combination of the three threonines as a sensitive amplifier of the JNK cascade. On the other hand, the JNK triggered survival pathway is inhibited by a survival pathway initiate by lithium which represses pro-apoptotic c-Jun/Ap-1 target genes.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.